kanharesorts.in provides Kanha National Park, Kanha Tour Operator, Kanha Packages, Resort In Kanha, Online Safari Booking Kanha

2.72 Rating by CuteStat

kanharesorts.in is 1 decade 9 months old. It is a domain having in extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, kanharesorts.in is SAFE to browse.

PageSpeed Score
63
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.254.234.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 9
H3 Headings: 5 H4 Headings: 10
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 30
Google Adsense: Not Applicable Google Analytics: UA-63984967-1

Websites Hosted on Same IP (i.e. 192.254.234.33)

E-rim | Upgrade your bike to an e-bike

- e-rim.com

Simply replace your front bicycle wheel with the E-rim. Instantly receive a 30 miles range with 16 mph top speed. Put on more miles in a breeze.

294,229 $ 30,240.00

EZ Tutorials for Beginner to Advanced - Tutsout

- tutsout.com

If you are in geo1, call us today! Tutsout

Not Applicable $ 8.95

Breakfast Sandwich Maker Recipes

- breakfastsandwichmakerrecipes.com
Not Applicable $ 8.95

Drew Martens | Creative Perceptions

- drewmartens.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- donnabellpsychotherapy.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.12.0
Date: Sat, 03 Jun 2017 11:45:52 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://www.kanharesorts.in/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip

Domain Information

Domain Registrar: Everest 43, LLC
Registration Date: Jul 11, 2013, 12:00 AM 1 decade 9 months 3 weeks ago
Last Modified: Jun 14, 2016, 12:00 AM 7 years 10 months 4 weeks ago
Expiration Date: Jul 11, 2018, 12:00 AM 5 years 10 months 19 hours ago
Domain Status:
CLIENT DELETE PROHIBITED
CLIENT RENEW PROHIBITED
CLIENT TRANSFER PROHIBITED
CLIENT UPDATE PROHIBITED
Owner's E-Mail: 3ghchvy4ramu8rdkhkeb@v.o-w-o.info

Domain Nameserver Information

Host IP Address Country
ns6489.hostgator.com 192.254.234.252 United States of America United States of America
ns6490.hostgator.com 192.254.234.253 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
kanharesorts.in A 14389 IP: 192.254.234.33
kanharesorts.in NS 86399 Target: ns6489.hostgator.com
kanharesorts.in NS 86399 Target: ns6490.hostgator.com
kanharesorts.in SOA 86399 MNAME: ns6489.hostgator.com
RNAME: root.gator3245.hostgator.com
Serial: 2016013000
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
kanharesorts.in MX 14399 Target: kanharesorts.in
kanharesorts.in TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D7474188-AFIN
Domain Name:KANHARESORTS.IN
Created On:11-Jul-2013 13:50:49 UTC
Last Updated On:14-Jun-2016 10:28:27 UTC
Expiration Date:11-Jul-2018 13:50:49 UTC
Sponsoring Registrar:GoDaddy.com, LLC (R101-AFIN)
Status:CLIENT DELETE PROHIBITED
Reason:
Status:CLIENT RENEW PROHIBITED
Reason:
Status:CLIENT TRANSFER PROHIBITED
Reason:
Status:CLIENT UPDATE PROHIBITED
Reason:
Registrant ID:CR147025099
Registrant Name:Mangesh Wirulkar
Registrant Organization:
Registrant Street1:175, Ayodhya Nagar,Behind gajana mandir,
Registrant Street2:
Registrant Street3:
Registrant City:Nagpur
Registrant State/Province:Maharashtra
Registrant Postal Code:440022
Registrant Country:IN
Registrant Phone:+7.12
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Email:mangeshbulkar@gmail.com
Admin ID:CR147025101
Admin Name:Mangesh Wirulkar
Admin Organization:
Admin Street1:175, Ayodhya Nagar,Behind gajana mandir,
Admin Street2:
Admin Street3:
Admin City:Nagpur
Admin State/Province:Maharashtra
Admin Postal Code:440022
Admin Country:IN
Admin Phone:+7.12
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Email:mangeshbulkar@gmail.com
Tech ID:CR147025100
Tech Name:Mangesh Wirulkar
Tech Organization:
Tech Street1:175, Ayodhya Nagar,Behind gajana mandir,
Tech Street2:
Tech Street3:
Tech City:Nagpur
Tech State/Province:Maharashtra
Tech Postal Code:440022
Tech Country:IN
Tech Phone:+7.12
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Email:mangeshbulkar@gmail.com
Name Server:NS6489.HOSTGATOR.COM
Name Server:NS6490.HOSTGATOR.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned